PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10001458
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 323aa    MW: 35749.9 Da    PI: 7.0758
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10001458genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grW++eEd+ll+d++   G g+Wk+ ++  g++R++k+c++rw +yl
      Lus10001458 14 KGRWSAEEDQLLADYIVANGEGSWKSLPQNAGLKRCGKSCRLRWVNYL 61
                     79********************************************97 PP

2Myb_DNA-binding42.71.3e-1367112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +t E e ++++++ lG++ W+tIa+ +  gRt++++k++w+++l
      Lus10001458  67 RGNISTAEAETILNLHTCLGNR-WSTIASQLS-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-20564IPR009057Homeodomain-like
PROSITE profilePS5129420.096965IPR017930Myb domain
SuperFamilySSF466891.76E-2511108IPR009057Homeodomain-like
SMARTSM007171.6E-111363IPR001005SANT/Myb domain
PfamPF002491.3E-141461IPR001005SANT/Myb domain
CDDcd001671.02E-71661No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2165115IPR009057Homeodomain-like
PROSITE profilePS5129415.26666116IPR017930Myb domain
SMARTSM007179.8E-1066114IPR001005SANT/Myb domain
PfamPF002497.3E-1067112IPR001005SANT/Myb domain
CDDcd001671.14E-571112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRKPCCDKV GLKKGRWSAE EDQLLADYIV ANGEGSWKSL PQNAGLKRCG KSCRLRWVNY  60
LKSDIKRGNI STAEAETILN LHTCLGNRWS TIASQLSGRT DNEIKNYWNS HLSRNTHSFI  120
RPTATQPSLA TLVADVSKVG TTVVANTKRG RKTNNSSSSK RTKNGKTNIS KDTGKNVVSE  180
PSVVEKAVIT VSEPETGLAT TTKHPSPISY ISEETTCSRV MKEQKYNASL SWATEIPATP  240
WEKVLPLDEQ WDMDKDWDDV VSYCTKTSTM DSTVDPLIGW SWELYAGDGG LEAGRHNGVL  300
EFDDHDNDDD DKQTAFVNWL LS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-20121145106B-MYB
1h8a_C1e-191211425126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479507.14e-67PREDICTED: LOW QUALITY PROTEIN: myb-related protein Zm1
RefseqXP_010523975.15e-67PREDICTED: transcription factor MYB12-like isoform X2
SwissprotO222642e-66MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A0D2N9K23e-67A0A0D2N9K2_G
STRINGPOPTR_0010s15090.15e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.14e-66myb domain protein 12